Constructing Structural Profiles for Protein Torsion Angle Prediction
Zafer Aydin
1
, David Baker
2
and William Stafford Noble
3
1
Department of Computer Engineering, Abdullah Gul University, 38080, Kayseri, Turkey
2
Department of Biochemistry, University of Washington, Seattle, WA 98195 U.S.A.
3
Department of Genome Sciences, Department of Computer Science and Engineering,
University of Washington, Seattle, WA 98195 U.S.A.
Keywords:
Protein Torsion Angle Prediction, Structural Frequency Profiles, Template Scoring, Profile-Profile Alignment.
Abstract:
Structural frequency profiles provide important constraints on structural aspects of a protein and is receiving a
growing interest in the structure prediction community. In this paper, we introduce new techniques for scoring
templates that are later combined to form structural profiles of 7-state torsion angles. By employing various
parameters of target-template alignments we improve the quality and accuracy of structural profiles consider-
ably. The most effective technique is the scaling of templates by integer powers of sequence identity score in
which the power parameter is adjusted with respect to the similarity interval of the target. Incorporating other
alignment scores as multiplicative factors further improves the accuracy of profiles. After analyzing the indi-
vidual strengths of various structural profile methods, we combine them with ab-initio predictions of 7-state
torsion angles by a linear committee approach. We show that incorporating template information improves the
accuracy of ab-initio predictions significantly at all levels of target-template similarity even when templates
are distant from the target. Template scaling methods developed in this work can be applied in many other
prediction tasks and in more advanced methods designed for computing structural profiles.
1 INTRODUCTION
Protein 3D structure prediction benefits greatly from
prediction of various 1D and 2D structural attributes
such as secondary structure, backbone torsion (dihe-
dral) angles, solvent accessibility, disordered regions,
and contact maps (Cheng et al., 2008). Methods that
predict structural properties of proteins typically em-
ploy sequence-based frequency profiles in their fea-
ture sets to utilize information in similar proteins.
These profiles can be in the form of position specific
scoring matrices (PSSM) or hidden Markov models
(HMM) and can be derivedby aligning the amino acid
sequence of the query with sequences in a large pro-
tein database using an efficient algorithm such as PSI-
BLAST (Altschul et al., 1997) or HHBlits (Remmert
et al., 2011). Despite the many efforts for improving
the quality of sequence-based alignments and their
profiles, the accuracy of 1D and 2D predictions has
come to saturation due to the difficulty of eliminat-
ing false positives especially when the query sequence
diverges from those in the protein database consider-
ably. Recently, there has been a growing interest in
using structural profiles as input features for predict-
ing various structural characteristics of proteins. A
structural frequency profile is a position specific scor-
ing matrix (PSSM) that is constructed from the struc-
tural labels of templates (i.e., hit proteins) obtained
by aligning the target (i.e., query) against a set of pro-
teins. To date structural profiles have been derived
mainly for protein secondary structure (Li et al., 2012;
Cong et al., 2013); backbone structural motifs, sol-
vent accessibility, contact density (Mooney and Pol-
lastri, 2009); and shape strings (Sun et al., 2012).
To construct a structural profile, the occurrence
frequencies of template residues are accumulated fol-
lowed by a normalization step. Methods that have
been developed for this task mainly use Laplacian
counts, which is a technique that gives equal weights
to templates (Li et al., 2012). As an alternative to
the Laplacian count method, a new scoring technique
has been proposed which scale the templates by the
third power of sequence identity score and the struc-
tural quality information (Pollastri et al., 2007; Walsh
et al., 2009). In this paper, we propose new struc-
tural profile methods for 7-state torsion angles of pro-
teins by incorporating various score terms of HH-
search alignments (Soding, 2005) and by adjusting
26
Aydin Z., Baker D. and Noble W..
Constructing Structural Profiles for Protein Torsion Angle Prediction.
DOI: 10.5220/0005208500260035
In Proceedings of the International Conference on Bioinformatics Models, Methods and Algorithms (BIOINFORMATICS-2015), pages 26-35
ISBN: 978-989-758-070-3
Copyright
c
2015 SCITEPRESS (Science and Technology Publications, Lda.)
the power parameter according to the target-template
similarity.
Despite the variety of methods proposed for pre-
dicting backbone torsion angles of proteins (Singh
et al., 2014; Song et al., 2012; Wu and Zhang,
2008a; Faraggi et al., 2012; Shen et al., 2009; Ber-
janskii et al., 2006), less effort has been made to sys-
tematically incorporate structurally related templates
into torsion angle predictions (Mooney and Pollastri,
2009). To the best of our knowledge, there is no work
in the literature that inspects the accuracy of torsion
angle predictions at all levels of target-template simi-
larity (i.e., from easy to difficult targets). Therefore
after deriving structural profiles, we combine them
with ab-initio predictions of a two-stage classifier us-
ing a linear committee approach. Our method is able
to generate specific and effective predictions for tar-
gets at all difficulty levels. We achieve this by adjust-
ing the power parameter and the weight of the struc-
tural profiles with respect to the similarity interval of
the target.
2 METHODS
2.1 Backbone Torsion Angles
Each residue (i.e., amino acid) has three associated
torsion angles: φ, ψ, and ω. The angle φ denotes rota-
tion about theC
α
-N bond of the residue, ψ denotes ro-
tation about the bond linkingC
α
and the carbonyl car-
bon, and ω denotes rotation about the bond between
the carbonyl carbon of the current residue and the ni-
trogen of the next residue. We compute φ, ψ, and ω
from the 3-D coordinate information in Protein Data
Bank (PDB), which is the database of solved protein
structures. Each of these angles is constrained to the
range [−180, 180].
Following (Blum et al., 2008), we first subdivided
residues into five torsion angle classes, which repre-
sent the major clusters observed in PDB. However, to
reduce the imbalance in the sizes of these classes, we
further subdivided the two most common labels (A
and B) according to whether the secondary structure
class is loop or not. The resulting seven labels are
described in Table 1.
2.2 Torsion Angle Class Prediction
Based on the definition given in Table 1, the 7-state
torsion angle prediction problem can be stated as fol-
lows. For a given protein, the goal is to assign to each
amino acid a torsion angle label from the alphabet
{L, A, M, B, E, G, O} as shown in Fig. 1.
LWGLVKQGLKCEDCGMNVHHKCREKVANLC
MMELMGLBBBBLLLGMBBMAAAALLMMLMO
Figure 1: 7-state torsion angle class prediction problem.
The first row shows the amino acid sequence of the target
and the second row is the sequence of 7-state torsion angle
labels, which are defined according to Table 1.
2.3 Alignment Methods
2.3.1 Deriving Templates for Structural Profiles
In this paper, we used the HHsearch method (Soding,
2005) to detect the templates that are similar to
a given target. HHsearch first derives an HMM-
profile for the target and aligns it against a database
of HMM-profiles (Soding, 2005). At the end of
the alignment, it ranks the templates (i.e. hits)
according to a probability score ranging from 0%
to 100% and reports the ones that score above
a threshold. An example alignment is shown in
Fig. 2. We used the following commandline to
compute HMM-HMM alignments for each tar-
get:
./hhsearch -i protein.hhm -d hhm3 -o
protein.hhr -cpu 2 -mact 0.05 -ssw 0.11
-atab protein.start.tab -realign -E 100
-cov 20 -b 20
. We then selected the HMM-HMM
alignments that score above the given threshold as
the templates. Note that, HHsearch uses predicted
secondary structure to be able to compute sensitive
HMM-HMM alignments. We used the PSIPRED
version 2.61 (Jones, 1999) to predict secondary
structures. All these alignments were generated in
2011. Further details on HHsearch and the HMM-
HMM alignments can be found in the corresponding
documentation (Soding, 2006; Soding et al., 2012).
2.3.2 Generating Position-Specific Scoring
Matrices for the Ab-Initio Method
We employed PSSMs generated by the PSI-BLAST
(Altschul et al., 1997) and HHMAKE (Soding, 2005)
algorithms as input features. We used BLAST version
2.2.20 and the NCBI’s non-redundant (NR) database
dated June 2011 to generate PSI-BLAST PSSMs. We
generated the HMM-profiles by HHsearch version
1.5.1 (Soding, 2005). Note that in deriving the HH-
MAKE PSSMs we did not perform any HMM-HMM
alignments. After deriving PSSMs we scaled them to
the interval [0, 1] by applying a sigmoidal transforma-
tion. Detailed descriptions of the PSSMs and the sig-
moidal transformation can be found in (Aydin et al.,
2011).
ConstructingStructuralProfilesforProteinTorsionAnglePrediction
27
Table 1: 7-state torsion angle labels. The table lists the seven torsion angle classes, their definitions, and the percentage of
residues assigned to each class in the PDB-PC90 data set. ss denotes the secondary structure label of the amino acid residue.
Label Definition Percent
L |ω| ≥ 90, φ < 0, −125 < ψ ≤ 50, ss = loop 11.94
A |ω| ≥ 90, φ < 0, −125 < ψ ≤ 50, ss 6= loop 38.21
M |ω| ≥ 90, φ < 0, ψ ≤ −125 OR ψ > 50, ss = loop 20.08
B |ω| ≥ 90, φ < 0, ψ ≤ −125 OR ψ > 50, ss 6= loop 22.27
E |ω| ≥ 90, φ ≥ 0, |ψ| > 100 1.92
G |ω| ≥ 90, φ ≥ 0, |ψ| ≤ 100 4.73
O |ω| < 90 0.84
No 3
>3fy3A
Probab=100.00 E-value=3.6e-41 Score=236.01 Aligned_columns=201 Identities=22%
Q ss_pred CCEEECCC---EEE--ECCCCCEEEECCCC---EEEE-CHHCCCCCCCEEEEC-------------------CCCHHHHH
Q ss_conf 99896176---479--87898379944863---4985-133664889879976-------------------88256532
Q 2odlA.fasta 4 GMDVVHGT---ATM--QVDGNKTIIRNSVD---AIIN-WKQFNIDQNEMVQFL-------------------QENNNSAV 55
(372)
Q Consensus 4 g~~v~~g~---~~i--~~~~~~~i~q~s~~---~~~n-w~sFnIg~~~~v~f~-------------------q~~~a~vi 55
(372)
.+.|+.+. -.+ ..++.+.|+..+|. ..|| |++|||++.+.+.+| ...+|++|
T Consensus 1 ~gIv~~~~~~~~~v~~~~nG~~vinI~~Pn~~GiS~N~y~~FnV~~~G~vlNNs~~~~~t~l~G~i~~NpnL~~~~A~~I 80
(234)
T 3fy3A 1 NGIVPDAGHQGPDVSAVNGGTQVINIVTPNNEGISHNQYQDFNVGKPGAVFNNALEAGQSQLAGHLNANSNLNGQAASLI 80
(234)
T ss_dssp CCCEECSSTTCCEEEEETTTEEEEECCCCCTTSEEEEEEEECCBCTTCEEEEECSSCEEETTTEEECCCTTSSSCCCSEE
T ss_pred CCEEECCCCCCCEEEECCCCCEEEEEECCCCCCCEEEEEEEEECCCCCEEEECCCCCCCCCCCCEECCCCCCCCCCCCEE
T ss_conf 95663798988677755999328986678888534532012103999759965755453000202215753378764289
Figure 2: An example HMM-HMM alignment by HHsearch.
2.4 Structural Frequency Profiles for
7-State Torsion Angles
Our structural profile is a 7 × N matrix where rows
represent the torsion angle classes and columns de-
note the amino acids of the target. An example struc-
tural profile is illustrated in Fig. 3.
1 2 ... N
L 0.40
0.20 ... 0.18
A 0.17
0.30 ... 0.02
M 0.01
0.13 ... 0.08
B 0.03
0.07 ... 0.12
E 0.19
0.11 ... 0.04
G 0.16
0.09 ... 0.06
O 0.04
0.10 ... 0.50
Figure 3: A structural frequency profile for 7-state tor-
sion angle representation. Rows represent the torsion angle
classes and columns denote the amino acids of the target.
Each column sums to 1.
The entries of a structural frequency profile matrix
represent the propensity of having a particular torsion
angle class at a given amino acid residue of the tar-
get protein. It therefore acts as a signature summariz-
ing the 7-state torsion label expectancy of the target
residues. The entries of this matrix are normalized to
the interval [0,1] and each column sums to 1 similar
to a marginal a posteriori probability distribution. For
this reason, we denote a structural profile by P
s
(t
j
|y),
where t
j
is the torsion angle class of the j
th
residue
and y is the amino acid sequence of the target.
A structural profile can be obtained by collecting
the occurrence frequencies of the structure labels of
the template proteins. There could be various ap-
proaches for computing a structural frequency profile.
The following sections explain the methods that have
been implemented in this paper.
2.4.1 Laplacian Counts
The most straightforward approach for deriving a
structural frequency profile is to count the occurrence
frequencies of torsion angle labels that match to a
given position of the target, which is followed by a
normalization step. The Laplacian count method is
employed by most of the approaches that have been
proposed for computing structural profiles to date (Li
et al., 2012). First a count matrix C is obtained that
contains the occurrence frequencies of the structure
labels of the templates, which is formulated as fol-
lows
C(i, j) =
∑
A( j,k)
δ(T( j, k), i) (1)
where C(i, j) is the (i, j)
th
entry of the count matrix
BIOINFORMATICS2015-InternationalConferenceonBioinformaticsModels,MethodsandAlgorithms
28
such that i ∈ {L, A, M, B, E, G, O} is the torsion angle
class, j is the residue position of the target, A( j, k) is
the residue of the k
th
database protein aligned to the
j
th
position, T( j, k) is the corresponding torsion an-
gle class of the template, and δ(T( j, k), i) is the Kro-
necker delta function defined as
δ(t, i) =
1 if t = i
0 otherwise
(2)
In other words, each torsion angle label that is
aligned to the j
th
position of the target contributes by
a count of 1, which is also known as the Laplacian
count method. Once the count matrix is obtained it
is normalized so that each column sums to 1. This is
formulated as
M
a
(i, j) =
(
C(i, j)
∑
i
C(i, j)
if |A( j)| > 0
0 otherwise
(3)
where A( j) is the set of all residues aligned to the j
th
residue of the target, |A( j)| is the number of residues
in A( j), and M
a
is the normalized count matrix. In this
formulation, the residues of the target are divided into
two categories. In the first group, we have “aligned”
positions (represented by the condition |A( j)| > 0)
where at least one residue is aligned from a database
protein and in the second group there is the set of “un-
aligned” positions (i.e., the case where |A( j)| = 0) for
which no residues are aligned from any hits. The sec-
ond condition is realized for positions that correspond
to gapped regions and for positions that are left out of
the aligned regions when a local alignment algorithm
is employed.
After the normalization step, the structural profile
matrix can be computed as
M(i, j) =
M
a
(i, j) if |A( j)| > 0
M
b
(i, j) otherwise
(4)
where M
b
(i, j) is the background probability of align-
ing a template residue with torsion class i to the j
th
residue of the target. In this paper, we use predictions
from the ab-initio classifier for the background distri-
bution of torsion angle labels.
2.4.2 Weighing Hits by Integer Powers of
Sequence Identity Scores
A second method for computing structural profiles
weights templates by integer powers of the sequence
identity score. In HHsearch, this score is computed
for each target template pair and is represented by the
“Identities” field as shown in Fig. 2. We first divide
this score by 100 and convert it to a weight value. We
then compute an integer power of this weight, which
is used to scale templates that contribute to the struc-
tural profile. This is expressed in the equations below
C(i, j) =
∑
A( j,k)
θ(T( j, k), i) (5)
θ(t, i) =
I
a
if t = i
0 otherwise
(6)
where C is the count matrix, θ is the new occurrence
count function replacing the Kronecker delta in Eq.
2, I is the sequence identity score of the k
th
template
and a is an integer that represents the strength of the
amplification one wishes to impose on the structurally
similar templates. The remaining terms are the same
as their counterparts in Eqs. 1 and 2. This type of
template scaling has two benefits. The first one is re-
lated to scaling templates by sequence identity scores,
which increases the contribution of structurally closer
templates while reducing the votes of distant ones.
The second benefit comes by taking integer powers
of I, which manages the situation where a handful of
structurally similar templates are followed by many
less similar or distant templates. In such a scenario,
if we use the Laplacian counts as in Section 2.4.1
or weigh templates by sequence identity scores only
(i.e., a = 1) the contribution of the similar templates
would be suppressed by many structurally less simi-
lar candidates. To further amplify the effect of struc-
turally similar templates and to reduce the contribu-
tion of false positives (i.e., noise) it is useful to take
integer powers of the sequence identity scores as for-
mulated in Eq. 6. Once we compute the count matrix,
we normalize it as in Eq. 3. All the other steps in de-
riving the structural profile are the same as in Section
2.4.1.
2.4.3 Incorporating Quality of Templates
In addition to taking integer powers of the sequence
identity score, it is also possible to include other
weight factors to the score function in Eq. 6. One
such measure assesses the experimental quality of the
templates and is proposed in (Pollastri et al., 2007;
Walsh et al., 2009). When we employ this approach
to score the templates, Eq. 6 takes the following form:
θ(t, i) =
I
a
q
if t = i
0 otherwise
(7)
where q is the quality of the template computed as X-
ray resolution + R-factor / 20 as proposed in (Hobohm
and Sander, 1994). According to this measure, a tem-
plate with a higher experimental quality has a lower
q parameter. Since this measure requires the X-ray
ConstructingStructuralProfilesforProteinTorsionAnglePrediction
29
resolution of the template, we apply it to those tem-
plates that have been solved by the X-ray method only
ignoring the remaining templates for the target.
2.4.4 Incorporating Other Alignment Scores
When two proteins are aligned to each other, typ-
ically several score terms are calculated for assess-
ing the statistical significance including e-value, raw
similarity score, and percentage of sequence iden-
tity. Employing these terms in scaling the templates
could also be useful in constructing a structural pro-
file. With this motivation, we first incorporated the
e-value score into the occurrence count function by
converting it to a multiplicative weight factor as in
(Wu and Zhang, 2008b). This is formulated as
θ(t, i) =
w
e
I
a
if t = i
0 otherwise
(8)
where w
e
is the e-value weight defined as
w
e
=
1 if E < 10
−10
−0.05log
10
(E) + 0.5 if 10
−10
≤ E < 10
10
0 otherwise
(9)
such that E is the E-value of the alignment. Note that
we dropped the quality term as it did not bring any
significant benefits, which is verified by our simula-
tions. According to Eq. 9, w
e
is set to 1 when the
target-template similarity is above a certain threshold
(E − value < 10
−10
) and decreases linearly as the E-
value of the target-template alignment is greater than
10
−10
until it becomes considerably high (i.e., 10
10
),
in which case it is set to zero.
In addition to the E-value, we also considered in-
corporating the overall raw similarity score of the
alignment into our structural profiles. For this pur-
pose, we modified the occurrence count function as
θ(t, i) =
sw
e
I
a
if t = i
0 otherwise
(10)
where s is the raw score of the alignment. For HH-
search, this is the overall similarity score obtained at
the end of the HMM-HMM alignment, which is com-
puted as the sum of the similarities of the aligned pro-
file columns minus the gap penalties (Soding, 2005).
A slight variation of this approach normalizes the raw
score with the length of the aligned region as
θ(t, i) =
s
L
w
e
I
a
if t = i
0 otherwise
(11)
such that L is the length of the aligned region and is
given as the field denoted as “Aligned
columns” in
HHsearch’s output (see Fig. 2).
2.4.5 Scaling Columns of the Alignment
Up to this point, we scaled the templates uniformly
throughout the aligned positions without discriminat-
ing the individual columns of the alignment. In this
section, we explain an approach for amplifying lo-
cal regions within an alignment that could potentially
contribute more accurate torsion label information
and suppressing those that could be locally more dis-
tant. For this purpose, we include the similarity score
between the aligned residues from a BLOSUM ma-
trix into the occurrence count function as formulated
below
θ(t, i) =
s
L
w
e
I
a
e
b
if t = i
0 otherwise
(12)
where b is the similarity score such as BLOSUM ma-
trix score between the j
th
residue of the target and
the residue in the template that is aligned to the target
residue. When the two residues are biologically simi-
lar to each other we expect this score term to be larger
than the term obtained from dissimilar pairings. This
approach has the potential to amplify local matches
between motifs that are common both in the target
and the template. Note that normalizing the sequence
alignment score with L is optional. For instance, a
slightly modified version of Eq. 12 does not perform
such type of normalization:
θ(t, i) =
sw
e
I
a
e
b
if t = i
0 otherwise
(13)
2.5 Prediction Model
2.5.1 Ab-initio Predictor
Our ab-initio torsion class predictor is a hybrid ar-
chitecture, in which four dynamic Bayesian network
(DBN) models are combined with a neural network.
Two of the DBNs use PSSMs derived by PSI-BLAST
(Altschul et al., 1997) and the other two use PSSMs
from the HHMAKE module of the HHsearch method
(Soding, 2005). Details of the ab-initio predictor can
be found in (Aydin et al., 2011; Aydin et al., 2012).
For simplicity we treat the output signal of the neural
network as a probability distribution due to the con-
straints it satisfies (i.e., it sums to 1 and takes values
from 0 to 1). This distribution is denoted as P
a
(t
j
|x),
which represents the ab-initio likelihood of the j
th
residue to have t
j
as the torsion angle label given x,
the set of input features around position j. Hence our
neural network predicts the torsion angle label of the
residue at the center of the feature window by select-
BIOINFORMATICS2015-InternationalConferenceonBioinformaticsModels,MethodsandAlgorithms
30
ing the particular label with the maximum discrimi-
nant score at the output layer. This is formulated as
t
∗
j
= argmax
t
j
P
a
(t
j
|x). (14)
2.5.2 Committee Predictor
The committee predictor combines the ab-initio pre-
dictions of torsion angle classes with the structural
frequencyprofile according to the following equation:
P
c
(t
j
|x, y) =
(1− λ)P
a
(t
j
|x) + λP
s
(t
j
|y) if aligned
P
a
(t
j
|x) if unaligned
(15)
where P
c
(t
j
|x, y) is the combined likelihood of having
torsion angle label t
j
for the residue at position j, λ is
the weight assigned to the structural profile, x is the
feature set of the ab-initio predictor described in Sec-
tion 2.5.1, y is the amino acid sequence of the target,
P
a
(t
j
|x) is the distribution of torsion angle classes ob-
tained from the ab-initio predictor, and P
s
(t
j
|y) is the
structural profile computed from the templates. Ac-
cording to this equation, the combined likelihood is
the weighted average of the ab-initio predictions and
the structural profile for positions that are aligned to
at least one template residue and it becomes equal to
the likelihood of the ab-initio predictor only for the
remaining positions.
After computing P
c
(t
j
|x, y), we predict the torsion
angle class of the j
th
residue as the particular label
that maximizes P
c
(t
j
|x, y) as
t
∗
j
= argmax
t
j
P
c
(t
j
|x, y), (16)
where t
∗
j
is the final prediction of the committee
method.
2.6 Datasets
2.6.1 PDB-PC90 Dataset
To obtain the PDB-PC90 dataset, we used the PISCES
server (Wang and Dunbrack, Jr., 2003; Wang and
Dunbrack, Jr., 2005) with the following set of crite-
ria: percent identity threshold of 90%, resolution cut-
off of 2.5
˚
A, and R-value cutoff of 1.0. We also used
PISCES to filter out non-X-ray and C
α
-only struc-
tures and to remove short (< 30 amino acids) and long
(> 10000 amino acids) chains. This dataset contained
17056 chains.
2.6.2 Training and Test Set
We randomly selected 5161 proteins from the PDB-
PC90 dataset. Among those, we randomly selected
a set of 994 proteins for the test set. From the set
of 5161 proteins, we then removed those proteins
that are similar to the test set using a 10% sequence
identity threshold. The remaining set contained 4205
chains, which is used to train our ab-initio prediction
method. We computed the HHsearch alignments for
the set of 994 proteins, which are used for computing
the structural profiles of torsion angle classes and for
predicting the torsion angle classes.
2.6.3 Similarity Intervals and Subsets of the Test
Set
To distinguish easy targets from difficult ones, we de-
fined similarity intervals using the HHsearch align-
ments from half of the proteins in our test set (see Sec-
tion 2.6.2). For each target, we first selected the max-
imum sequence identity score from the set of target-
template alignments. Then we ranked those scores
and defined percentile intervals of sequence identity
with increments of 5%. This initially produced a total
of 20 intervals. We combined the eigth and ninth in-
tervals as the maximum sequence identity scores for
those targets were very close to each other. We also
combined the tenth up to the twentieth intervals since
the maximum sequence identity score was 100% for
all the targets in those bins. This procedure resulted
in a total of 9 sequence identity intervals. In the last
step, we further reduced the number of intervals to 5
by combining the 2nd and 3rd, 4th and 5th, and 7th up
to 9th intervals. The resulting intervals are tabulated
below
According to Table 2, the first interval represents
targets with the most distant templates (i.e., those
with the maximum sequence identity score of 26%
or less) and the last interval represents targets that
contain highly similar templates (i.e., those with the
maximum sequence identity score greater than 80%).
Based on this binning, we further divided our test set
of 994 proteins (see the previous section) into 5 sub-
sets such that each contained those targets that fall
into one and only one of the intervals defined in Table
2. The number of proteins and amino acids in each of
these subsets are summarized in Table 3.
Note that the number of proteins in each subset is
not uniformly the same (especially true for the last
set that contains targets from the “High” category)
mainly because datasets have been constructed by
random sampling from PDB without enforcing spe-
cific constraints for having equal number of samples
in each interval. Nonetheless we have enough sam-
ples in each subset mainly because the torsion angle
class prediction is performed on each residue sepa-
rately. Furthermore the proportion of target positions
that are aligned to at least one template residue is con-
ConstructingStructuralProfilesforProteinTorsionAnglePrediction
31
Table 2: Intervals of sequence identity scores The intervals are defined by selecting the target-template alignments with
maximum sequence identity scores followed by sorting these scores in ascending order. Percentile increments of 5% results
in a total of 20 bins, which are further reduced to 5 intervals.
Interval Percentiles (%) Max Identity (%)
Low 0-5 0.0-26.0
Medium-Low 5-15 26.0-35.0
Medium 15-25 35.0-50.0
Medium-High 25-30 50.0-80.0
High 30-100 80.0-100.0
Table 3: The five subsets of the test set with 994 proteins. The number of proteins, the total number of amino acids and the
number of amino acids that are aligned to at least one template residue are shown for each subset. The subsets are derived
based on the intervals defined in Table 2.
Subset # proteins # residues # aligned res.
Low 56 12903 12665
Medium-Low 99 21792 21682
Medium 95 22596 22561
Medium-High 62 15326 15295
High 682 160037 159993
Total 994 232654 232196
siderably high. This shows that a structural profile
column is computed using the aligned templates for
most of the target residues.
3 RESULTS
We first compare the torsion angle label accuracy of
the structural profiles on positions that are aligned to
templates only. For this purpose, we implemented the
profile methods summarized in Table 4.
In SP4, we modify the power of the sequence
identity score term (i.e., a) according to the similar-
ity interval the target belongs to. For this purpose, we
use the following mapping to define a:
a =
1 if target in Low Interval
3 if target in Medium-Low Interval
5 if target in Medium Interval
7 if target in Medium-High Interval
9 if target in High Interval
(17)
where the interval of the target is defined according
to Table 2. In SP9 and SP10 we use the BLOSUM62
matrix to scale individual columns of the alignment as
formulated in Eqs. 12 and 13. In SP9, we employed
the BLOSUM scores uniformly for all columns of the
alignment whereas in SP10, we utilized the BLOSUM
scores for targets in the “High” interval only. If the
target belongs to one of the remaining four intervals
then we turn off this score term in Eq. 13. In that case
this equation takes the following form
θ(t, i) =
sw
e
I
a
if t = i
0 otherwise
(18)
Once we compute a structural profile, we predict
the torsion angle class of the aligned target residues
by selecting the particular label that yields the max-
imum value in the corresponding column of the pro-
file.
Following these definitions, the torsion angle class
prediction accuracy of the structural profiles listed in
Table 4 is summarized in Table 5 below. In this table,
Overall 1 is the number of correctly predicted amino
acids divided by the total number of amino acids for
which a structural profile column is computed (i.e.,
those that are aligned to at least one template). The
second up to the sixth columns show accuracies for
the five similarity intervals and are computed on each
subset of the test set. Overall 2 is the average of
the five accuracies obtained for Low to High inter-
vals. It estimates the accuracy we would obtain had
we used equal number of amino acids for each of the
five intervals. Based on these results, the most ac-
curate structural profile method is SP10 though other
methods such as SP7, SP4 and SP8 are also quite ef-
fective. SP10 outperforms SP1, (the Laplacian count
method), by 14.53%, which is a statistically signifi-
cant improvement. It is also better than SP5 by 1.2%,
which was proposed in (Pollastri et al., 2007; Walsh
et al., 2009). This improvement is also statistically
significant (with a p-value < 0.0001 from a two-tailed
Z-test at a significance level of 0.01).
After establishing that the new structural profile
methods contain more accurate torsion angle infor-
mation than the approaches proposed in the literature,
we evaluated the accuracy when the structural pro-
files are combined with an ab-initio predictor. For
this purpose, we trained our ab-initio method us-
BIOINFORMATICS2015-InternationalConferenceonBioinformaticsModels,MethodsandAlgorithms
32
Table 4: The implemented structural profile methods and their descriptions. Further details can be found in Section 2.4.
Structural Profile and Desciption
SP1: Eq. 1, Laplacian
SP2: Eq. 6, a = 1
SP3: Eq. 6, a = 3
SP4: Eq. 6, a varies wrt similarity interval
SP5: Eq. 7, quality, a = 3, (Pollastri et al.)
SP6: Eq. 8, E-value, a = 3
SP7: Eq. 10, E-value, align. score, a = 3
SP8: Eq. 11, E-value, norm. align. score, a = 3
SP9: Eq. 12, E-value, norm. align. score, BLOSUM62, a = 3
SP10: Eq. 13, E-value, align. score, a varies, BLOSUM62 scores if target is in High interval only
Table 5: 7-state torsion angle prediction accuracy of structural profiles. L: Low, ML: Medium-Low, M: Medium, MH:
Medium-High, H: High. Only target residues that are aligned to at least one template are considered.
Profile L ML M MH H Overall 1 Overall 2
SP1 66.49 69.83 71.94 74.46 75.66 74.17 71.68
SP2 66.85 70.71 73.93 80.07 81.96 79.18 74.70
SP3 66.68 72.20 77.82 86.64 92.87 87.64 79.24
SP4 66.85 72.20 79.40 87.92 93.47 88.30 79.97
SP5 66.53 72.13 77.28 87.07 92.73 87.50 79.15
SP6 67.15 73.26 78.89 87.13 93.06 88.03 79.90
SP7 66.48 74.11 80.23 87.66 93.30 88.40 80.36
SP8 66.59 73.91 80.13 87.31 93.25 88.33 80.24
SP9 65.05 72.19 78.30 86.39 93.68 88.14 79.12
SP10 66.55 74.11 80.71 87.36 93.69 88.70 80.48
ing the training set described in Section 2.6.2 and
computed 7-state torsion angle predictions on all the
amino acids of the test set. We then combined those
predictions with a structural profile as in Eq. 15. For
the target residues that were not aligned to any tem-
plate, we simply took predictions from the ab-initio
method. Regarding the λ parameter (i.e., the weight
of the structural profile) we considered two possibil-
ities. The first approach sets λ to 0.5 and the second
one modifies it according to the similarity interval of
the target according to the following function
λ =
0.5 if target in Low Interval
0.6 if target in Medium-Low Interval
0.7 if target in Medium Interval
0.8 if target in Medium-High Interval
0.9 if target in High Interval
(19)
In this equation, λ is gradually increased as the
similarity interval of the target approaches to the
“High” interval thereby giving more weight to the
structural profile than the ab-initio predictor. Table 6
summarizes the accuracy of committee predictors that
combine the ab-initio method with various structural
profiles. In addition to the overall accuracy measure,
we also included the segment overlap (SOV) measure
that is used in 1D structure prediction to assess the
accuracy at the segmental level (Zemla et al., 1999).
The SOV measure depicts how well the predicted tor-
sion label segments match the true segments and is
biologically more meaningful than the residue level
accuracy.
According to this table, the ab-initio+SP10
method (with variable λ parameter) is better than
the ab-initio+SP5 method in all categories. The im-
provements are 2.78% in Overall 1, 3.40% in Over-
all 2, 3.57% in SOV, 1.65% in Low interval, 2.74%
in Medium-Low interval, 4.90% in Medium inter-
val, 4.82% in Medium-High interval and 2.86% in
High interval. When ab-initio+SP10 is compared
with ab-initio+SP1 (i.e., the Laplacian method) for
λ = 0.5, the improvements are 12.20% in Overall 1,
6.68% in Overall 2, 13.62% in SOV, 0.12% in Low
interval, 2.59% for Medium-Low interval, 4.59% in
Medium interval, 10.43% in Medium-High interval
and 15.66% in High interval. Adjusting the λ param-
eter with respect to the similarity interval was partic-
ularly useful for the ab-initio+SP5 method. In other
words, when λ is set to 0.5 uniformly for all similar-
ity intervals, the accuracy of ab-initio+SP5 dropped
significantly higher than the ab-initio+SP10. This
shows that the proposed structural profile SP10 is
more useful than SP5 when combined with the ab-
initio method. This is because torsion label errors of
SP10 and the ab-initio method overlap less as com-
pared to SP5 and therefore SP10 provides a better
complement to the ab-initio predictor. Another ob-
servation one can make is the improvement over the
ab-initio method when structural profiles are incor-
ConstructingStructuralProfilesforProteinTorsionAnglePrediction
33
Table 6: 7-state torsion angle prediction accuracy of methods that incorporate structural profiles with ab-initio pre-
dictions. L: Low, ML: Medium-Low, M: Medium, MH: Medium-High, H: High. All target residues in the test set are
considered.
Method L ML M MH H Overall 1 Overall 2 SOV
Ab-initio 72.36 73.96 73.58 73.35 74.01 73.83 73.45 71.33
Ab-initio + SP1, λ = 0.5 74.47 75.42 76.10 76.94 77.96 77.28 76.18 74.49
Ab-initio + SP5, λ = 0.5 72.39 74.19 74.19 75.53 78.28 76.99 74.92 74.52
Ab-initio + SP10, λ = 0.5 74.59 78.01 80.69 87.37 93.62 89.10 82.86 88.11
Ab-initio + SP5, λ as in Eq. 19 72.94 75.21 77.22 83.86 90.99 86.70 80.04 85.19
Ab-initio + SP10, λ as in Eq. 19 74.59 77.95 82.12 88.68 93.85 89.48 83.44 88.76
porated. This is true even for the Low interval (an
improvement of 2.23%) and is partly because of the
sensitive nature of HMM-HMM profile alignments
and also because HHsearch uses predicted secondary
structure from PSIPRED (Jones, 1999) to align a pair
of HMMs.
In addition to the structural profile methods de-
scribed above, we also considered three other ap-
proaches. The first one incorporates the probabil-
ity score of HMM-profile alignments into Eq. 13
as a multiplicative factor to globally scale the tem-
plates and the second method incorporates the col-
umn score of HHsearch alignments to amplify local
regions that are well conserved (e.g. motifs). These
two approaches did not bring any reasonable change
in the accuracy measures (result not shown). As a
third approach we considered employing Henikoff
weights (Henikoff and Henikoff, 1994) to scale the
count information of templates before constructing
the structural profiles. We applied this weighting pro-
cedure for the following three scenarios: (1) weights
based on matched residues only, (2) weights based
on torsion angle labels only, (3) weights based on
residue and torsion angle tuples. Unfortunately, in
all three cases, torsion angle prediction accuracy was
significantly lower than the level achieved by other
scaling methods considered in this paper (result not
shown). Note that we did not consider utilizing a
background distribution in Eq. 4 for torsion angle
labels mainly because we use predictions from our
ab-initio method, which would eventually contain a
more accurate torsion angle representation than a sim-
ple background distribution.
Finally, we would like to state that we are unable
to compare our torsion angle class predictor with the
literature mainly because there is no other work that
performs 7-state torsion angle prediction on the same
set of alphabet. However we had shown in an ear-
lier paper that a 5-state version of our predictor pro-
vides results comparable to the state-of-the-art in the
ab-initio setting (Aydin et al., 2012).
4 CONCLUSIONS
In this paper, we propose novel methods for scaling
templates to construct structural profiles of torsion an-
gle states. Though we use the score terms in HH-
search method, our approach is generic and most of
the structural profile methods proposed in this work
can also be implemented using other alignment meth-
ods including PSI-BLAST. Second, the scaling tech-
niques can be applied in many other tasks such as sec-
ondary structure prediction, solvent accessibility pre-
diction, contact map prediction, and 3D structure pre-
diction. Third, they can easily be incorporated into
other methods that have been developed for deriving
structural profiles from templates.
The proposed methods can be improved in several
ways. First of all, certain parameters of the method
can be optimized such as the power of sequence iden-
tity score and the weight that is used to combine struc-
tural profiles with ab-initio predictions. Addition-
ally, the templates can be scaled in a position-specific
manner using the confidence scores, which are now
available in HHBlits (the new version of HHsearch).
A third technique uses templates that score within a
window only instead of taking all the templates that
scored above a threshold. This approach can be com-
bined with the existing techniques presented in this
work to reduce the computational cost. Finally, in-
stead of using a linear model, the ab-initio predictions
can be combined with structural profiles using more
advanced models such as neural networks. We be-
lieve that all these efforts will potentially improve the
accuracy of structure prediction tasks further.
ACKNOWLEDGEMENTS
This work is supported by grant 113E550 from
3501 TUBITAK National Young Researchers Career
Award.
BIOINFORMATICS2015-InternationalConferenceonBioinformaticsModels,MethodsandAlgorithms
34
REFERENCES
Altschul, S. F., Madden, T. L., Schaffer, A. A., Zhang,
J., Zhang, Z., Miller, W., and Lipman, D. J. (1997).
Gapped BLAST and PSI-BLAST: A new generation
of protein database search programs. 25:3389–3402.
Aydin, Z., Singh, A., Bilmes, J., and Noble, W. S. (2011).
Learning sparse models for a dynamic Bayesian net-
work classifier of protein secondary structure. BMC
Bioinformatics, 12:154.
Aydin, Z., Thompson, J., Bilmes, J., Baker, D., and Noble,
W. S. (2012). Protein torsion angle class prediction
by a hybrid architecture of bayesian and neural net-
works. In 13th International Conference on Bioinfor-
matics and Computational Biology.
Berjanskii, M. V., Neal, S., and Wishart, D. S. (2006).
PREDITOR: a web server for predicting protein tor-
sion angle restraints. Nucleic Acids Research, 34(Web
Server Issue):W:63–69.
Blum, B., Jordan, M., Kim, D., Das, R., Bradley, P., and
Baker, D. (2008). Feature selection methods for im-
proving protein structure prediction with Rosetta. In
Platt, J., Koller, D., Singer, Y., and Roweis, S., editors,
Advances in Neural Information Processing Systems
20, pages 137–144. MIT Press, Cambridge, MA.
Cheng, J., Tegge, A. N., and Baldi, P. (2008). Ma-
chine learning methods for protein structure predic-
tion. IEEE Reviews in Biomedical Engineering, 1:41–
49.
Cong, P., Li, D., Wang, Z., Tang, S., and Li, T. (2013).
Spssm8: An accurate approach for predicting eight-
state secondary structures of proteins. Biochimie,
95(12):2460–2464.
Faraggi, E., Zhang, T., Yang, Y., Kurgan, L., and Zhou, Y.
(2012). SPINE X: improving protein secondary struc-
ture prediction by multistep learning coupled with
prediction of solvent accessible surface area and back-
bone torsion angles. PLoS One, 7(2):e30361.
Henikoff, S. and Henikoff, J. G. (1994). Position-based se-
quence weights. 243:574–578.
Hobohm, U. and Sander, C. (1994). Enlarged representative
set of protein structures. Protein Science, 3:522–524.
Jones, D. T. (1999). Protein secondary structure prediction
based on position-specific scoring matrices. 292:195–
202.
Li, D., Li, T., Cong, P., Xong, W., and Sun, J. (2012). A
novel structural position-specific scoring matrix for
the prediction of protein secondary structures. Bioin-
formatics, 28(1):32–39.
Mooney, C. and Pollastri, G. (2009). Beyond the twilight
zone: Automated prediction of structural properties of
proteins by recursive neural networks and remote ho-
mology information. Proteins: Structure, Function,
and Bioinformatics, 77:181–190.
Pollastri, G., Martin, A. J. M., Mooney, C., and Vullo,
A. (2007). Accurate prediction of protein secondary
structure and solvent accessibility by consensus com-
biners of sequence and structure information. BMC
Bioinformatics, 8(201).
Remmert, M., Biegert, A., Hauser, A., and Soding, J.
(2011). Hhblits: lightning-fast iterative protein se-
quence searching by hmm-hmm alignment. Nature
Methods, 9(2):173–175.
Shen, Y., Delaglio, F., Cornilescu, G., and Bax, A. (2009).
TALOS+: a hybrid method for predicting protein
backbone torsion angles from nmr chemical shifts.
Journal of Biomolecular NMR, 44(4):213–223.
Singh, H., Singh, S., and Raghava, G. P. S. (2014). Eval-
uation of protein dihedral angle prediction methods.
PLoS One, 9(8):e105667.
Soding, J. (2005). Protein homology detection by HMM-
HMM comparison. Bioinformatics, 21:951–960.
Soding, J. (2006). Quick guide to HHsearch.
ftp://toolkit.genzentrum.lmu.de/pub/HHsearch/old/
HHsearch/HHsearch1.5.1/HHsearch-guide.pdf.
Soding, J., Remmert, M., and Hauser, A. (2012). HH-suite
for sensitive sequence searching based on hmm-hmm
alignment. ftp://toolkit.genzentrum.lmu.de/pub/HH-
suite/hhsuite-userguide.pdf.
Song, J., Tan, H., Wang, M., Webb, G. I., and Akutsu, T.
(2012). TANGLE: two-level support vector regression
approach for protein backbone torsion angle predic-
tion from primary sequences. PLoS One, 7(2):e30361.
Sun, J., Tang, S., Xiong, W., Cong, P., and Li, T. (2012).
Dsp: a protein shape string and its profile predic-
tion server. Nucleic Acids Research, 40(W1):W298–
W302.
Walsh, I., Bau, D., Martin, A. J. M., Mooney, C., Vullo,
A., and Pollastri, G. (2009). Ab initio and template-
based prediction of multi-class distance maps by two-
dimensional recursive neural networks. BMC Struc-
tural Biology, 9(5).
Wang, G. and Dunbrack, Jr., R. L. (2003). PISCES:
a protein sequence culling server. Bioin-
formatics, 19:1589–1591. Web server at
http://dunbrack.fccc.edu/PISCES.php.
Wang, G. and Dunbrack, Jr., R. L. (2005). PISCES: re-
cent improvements to a pdb sequence culling server.
Nucleic Acids Res., 33:W94–W98. Web server at
http://dunbrack.fccc.edu/PISCES.php.
Wu, S. and Zhang, Y. (2008a). ANGLOR: A composite
machine-learning algorithm for protein backbone tor-
sion angle prediction. PLoS One, 3(10):e3400.
Wu, S. and Zhang, Y. (2008b). MUSTER: Improving pro-
tein sequence profile-profile alignments by using mul-
tiple sources of structure information. Proteins: Struc-
ture, Function, and Bioinformatics, 72(2):547–556.
Zemla, A., Venclovas, C., Fidelis, K., and Rost, B. (1999).
A modified definition of Sov, a segment-based mea-
sure for protein secondary structure prediction assess-
ment. Proteins, 34:220–223.
ConstructingStructuralProfilesforProteinTorsionAnglePrediction
35